Sermorelin Acetate 5mg Benefits

Sermorelin Acetate 5mg supports premium research performance, exceptional stability, and rigorous quality standards.
Lab-tested ingredients ensuring 99%+ purity, reliability, and consistency for UK research (featured under slu-pp-332 5mg and buy peptides uk).
Fast shipping available across the UK with discreet, secure, and climate-controlled packaging.

Sermorelin Acetate 5mg

Welcome to Sermorelin Acetate 5mg, premium research formulation designed for analytical applications in the UK. Our products are synthesised to exacting industry metrics, making them ideal for studies involving slu-pp-332 5mg, buy peptides uk, and peptides uk.

Overview and Research Applications of Sermorelin Acetate 5mg

Explore Endocrine Research with High-Purity Sermorelin Acetate – 5mg

Sermorelin Acetate is a synthetic peptide analogue of growth hormone–releasing hormone (GHRH), designed for advanced research into pituitary function, hormone signaling, and endocrine regulation. With a purity of ≥98%, this peptide provides consistent reliability for high-level laboratory investigations.

✅ ≥98% Purity – Research Grade
🔬 Designed for Endocrinology and Hormonal Pathway Studies
🧪 Precision-Manufactured Lyophilised Peptide

Product Details:
• Name: Sermorelin Acetate
• Quantity: 5mg
• Catalogue Number: UKSERM2
• Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S
• Molecular Weight: 3358.9 g/mol
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ (acetate salt)
• Form: Lyophilised Solid

Storage & Handling:
Sermorelin Acetate is supplied as a stable lyophilised powder to maintain integrity and maximize shelf life. Please consult our detailed guidelines for reconstitution and storage.

Note: This product is strictly for laboratory research use only. Not for human consumption or clinical application.

Quality Guarantee & Purity Testing for Sermorelin Acetate 5mg

Every batch of Sermorelin Acetate 5mg undergoes rigorous laboratory verification. For complete third-party certificate details and compliance, explore our Janoshik Testing Verification Hub.